GNaZ antibody
-
- Target See all GNaZ Antibodies
- GNaZ (Guanine Nucleotide Binding Protein (G Protein), alpha Z Polypeptide (GNaZ))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GNaZ antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GNAZ antibody was raised using a synthetic peptide corresponding to a region with amino acids LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT
- Top Product
- Discover our top product GNaZ Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GNAZ Blocking Peptide, catalog no. 33R-5047, is also available for use as a blocking control in assays to test for specificity of this GNAZ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAZ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNaZ (Guanine Nucleotide Binding Protein (G Protein), alpha Z Polypeptide (GNaZ))
- Alternative Name
- GNAZ (GNaZ Products)
- Synonyms
- GXA antibody, AI847979 antibody, Gz antibody, G protein subunit alpha z antibody, guanine nucleotide binding protein, alpha z subunit antibody, GNAZ antibody, Gnaz antibody
- Background
- GNAZ is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- G-protein mediated Events
-