GK2 antibody (C-Term)

Catalog No. ABIN632225

Product Details anti-GK2 Antibody

Target: GK2 (Glycerol Kinase 2 (GK2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GK2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GK2 antibody was raised against the C terminal of GK2

Purification: Affinity purified

Immunogen: GK2 antibody was raised using the C terminal of GK2 corresponding to a region with amino acids QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GK2 Blocking Peptide, catalog no. 33R-7592, is also available for use as a blocking control in assays to test for specificity of this GK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GK2

Target: GK2 (Glycerol Kinase 2 (GK2))

Alternative Name: GK2 (GK2 Products)

Synonyms: GKP2 antibody, GKTA antibody, Gk-rs2 antibody, N(alpha)-acetyltransferase 11, NatA catalytic subunit antibody, glycerol kinase 2 antibody, glycerol kinase antibody, NAA11 antibody, GK2 antibody, PPA_RS11645 antibody, ATEG_05802 antibody, AGROH133_15068 antibody, Gk2 antibody

Background: GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.

Molecular Weight: 61 kDa (MW of target protein)