GK2 antibody (C-Term)
-
- Target See all GK2 Antibodies
- GK2 (Glycerol Kinase 2 (GK2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GK2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GK2 antibody was raised against the C terminal of GK2
- Purification
- Affinity purified
- Immunogen
- GK2 antibody was raised using the C terminal of GK2 corresponding to a region with amino acids QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS
- Top Product
- Discover our top product GK2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GK2 Blocking Peptide, catalog no. 33R-7592, is also available for use as a blocking control in assays to test for specificity of this GK2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GK2 (Glycerol Kinase 2 (GK2))
- Alternative Name
- GK2 (GK2 Products)
- Synonyms
- GKP2 antibody, GKTA antibody, Gk-rs2 antibody, N(alpha)-acetyltransferase 11, NatA catalytic subunit antibody, glycerol kinase 2 antibody, glycerol kinase antibody, NAA11 antibody, GK2 antibody, PPA_RS11645 antibody, ATEG_05802 antibody, AGROH133_15068 antibody, Gk2 antibody
- Background
- GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.
- Molecular Weight
- 61 kDa (MW of target protein)
-