FAM45B antibody (Middle Region)

Catalog No. ABIN632226

Product Details anti-FAM45B Antibody

Target: FAM45B (Family with Sequence Similarity 45, Member B (Pseudogene) (FAM45B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM45B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM45 B antibody was raised against the middle region of FAM45

Purification: Affinity purified

Immunogen: FAM45 B antibody was raised using the middle region of FAM45 corresponding to a region with amino acids AEDPEKSESQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM45B Blocking Peptide, catalog no. 33R-1121, is also available for use as a blocking control in assays to test for specificity of this FAM45B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM45B

Target: FAM45B (Family with Sequence Similarity 45, Member B (Pseudogene) (FAM45B))

Alternative Name: FAM45B (FAM45B Products)

Synonyms: HT011 antibody, family with sequence similarity 45, member A pseudogene antibody, FAM45BP antibody

Background: The function of FAM45 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 40 kDa (MW of target protein)