ETF1 antibody (N-Term)
-
- Target See all ETF1 Antibodies
- ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ETF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ETF1 antibody was raised against the N terminal of ETF1
- Purification
- Affinity purified
- Immunogen
- ETF1 antibody was raised using the N terminal of ETF1 corresponding to a region with amino acids ISLIIPPKDQISRVAKMLADEFGTASNIKSRVNRLSVLGAITSVQQRLKL
- Top Product
- Discover our top product ETF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ETF1 Blocking Peptide, catalog no. 33R-4157, is also available for use as a blocking control in assays to test for specificity of this ETF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ETF1 (Eukaryotic Translation Termination Factor 1 (ETF1))
- Alternative Name
- ETF1 (ETF1 Products)
- Synonyms
- D5S1995 antibody, ERF antibody, ERF1 antibody, RF1 antibody, SUP45L1 antibody, TB3-1 antibody, AI463371 antibody, D6Ertd109e antibody, eRF1 antibody, zeh0057 antibody, hm:zeh0057 antibody, wu:fa19e07 antibody, wu:fi31f01 antibody, cl1 antibody, RRF1 antibody, DDBDRAFT_0188023 antibody, DDBDRAFT_0191343 antibody, DDB_0188023 antibody, DDB_0191343 antibody, CG5605 antibody, Dm0184 antibody, Dmel\\CG5605 antibody, Group J antibody, group J antibody, l(3)00103 antibody, l(3)05637 antibody, l(3)77ABb antibody, l(3)neo28 antibody, Eukaryotic release factor 1 antibody, eukaryotic translation termination factor 1 antibody, eukaryotic translation termination factor 1b antibody, eukaryotic translation termination factor 1 S homeolog antibody, eukaryotic peptide chain release factor subunit 1 antibody, eukaryotic petide chain release factor subunit 1 antibody, eukaryotic release factor 1 antibody, Eukaryotic peptide chain release factor subunit 1 antibody, ETF1 antibody, Etf1 antibody, etf1b antibody, etf1 antibody, etf1.S antibody, Tb11.22.0012 antibody, THAPSDRAFT_22240 antibody, TTHERM_00292170 antibody, LOC692937 antibody, erf1 antibody, eRF1 antibody, erfa-1 antibody
- Background
- Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP.
- Molecular Weight
- 49 kDa (MW of target protein)
-