IFI44 antibody (Middle Region)
-
- Target See all IFI44 Antibodies
- IFI44 (Interferon-Induced Protein 44 (IFI44))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IFI44 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IFI44 antibody was raised against the middle region of IFI44
- Purification
- Affinity purified
- Immunogen
- IFI44 antibody was raised using the middle region of IFI44 corresponding to a region with amino acids LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS
- Top Product
- Discover our top product IFI44 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IFI44 Blocking Peptide, catalog no. 33R-5042, is also available for use as a blocking control in assays to test for specificity of this IFI44 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI44 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFI44 (Interferon-Induced Protein 44 (IFI44))
- Alternative Name
- IFI44 (IFI44 Products)
- Synonyms
- MATP44 antibody, MTAP44 antibody, TLDC5 antibody, p44 antibody, A430056A10Rik antibody, AW261460 antibody, interferon induced protein 44 antibody, interferon-induced protein 44 antibody, IFI44 antibody, Ifi44 antibody
- Background
- This protein aggregates to form microtubular structures.
- Molecular Weight
- 50 kDa (MW of target protein)
-