SRRD antibody (Middle Region)
-
- Target See all SRRD Antibodies
- SRRD (SRR1 Domain Containing (SRRD))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SRRD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SRRD antibody was raised against the middle region of SRRD
- Purification
- Affinity purified
- Immunogen
- SRRD antibody was raised using the middle region of SRRD corresponding to a region with amino acids DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSA
- Top Product
- Discover our top product SRRD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SRRD Blocking Peptide, catalog no. 33R-1995, is also available for use as a blocking control in assays to test for specificity of this SRRD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRRD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRRD (SRR1 Domain Containing (SRRD))
- Alternative Name
- SRRD (SRRD Products)
- Synonyms
- HC/HCC antibody, SRR1L antibody, 2810002G02Rik antibody, Srr1 antibody, SRR1 domain containing antibody, SRRD antibody, Srrd antibody
- Background
- SRRD belongs to the SRR1 family. It may be involved in a circadian clock input pathway.
- Molecular Weight
- 38 kDa (MW of target protein)
-