CSNK1G3 antibody (Middle Region)
-
- Target See all CSNK1G3 Antibodies
- CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CSNK1G3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CK1 gamma 3 antibody was raised against the middle region of CSNK1 G3
- Purification
- Affinity purified
- Immunogen
- CK1 gamma 3 antibody was raised using the middle region of CSNK1 G3 corresponding to a region with amino acids LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP
- Top Product
- Discover our top product CSNK1G3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CK1 gamma 3 Blocking Peptide, catalog no. 33R-4875, is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))
- Alternative Name
- CK1 gamma 3 (CSNK1G3 Products)
- Synonyms
- CKI-gamma 3 antibody, CSNK1G3L antibody, 3300002K07Rik antibody, C330049O21Rik antibody, casein kinase 1 gamma 3 antibody, casein kinase 1 gamma 3 L homeolog antibody, casein kinase 1, gamma 3 antibody, CSNK1G3 antibody, csnk1g3 antibody, csnk1g3.L antibody, Csnk1g3 antibody
- Background
- Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1G3 can phosphorylate a large number of proteins. It participates in Wnt signaling.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Hedgehog Signaling
-