IFRD1 antibody (Middle Region)
-
- Target See all IFRD1 Antibodies
- IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IFRD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IFRD1 antibody was raised against the middle region of IFRD1
- Purification
- Affinity purified
- Immunogen
- IFRD1 antibody was raised using the middle region of IFRD1 corresponding to a region with amino acids LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF
- Top Product
- Discover our top product IFRD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IFRD1 Blocking Peptide, catalog no. 33R-4784, is also available for use as a blocking control in assays to test for specificity of this IFRD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFRD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))
- Alternative Name
- IFRD1 (IFRD1 Products)
- Synonyms
- im:7067566 antibody, si:dkey-192l17.2 antibody, wu:fi35f04 antibody, wu:fj67a06 antibody, zgc:154080 antibody, IFR1 antibody, PC4 antibody, TIS7 antibody, Ifnl antibody, Tis7 antibody, Pc4 antibody, interferon-related developmental regulator 1 antibody, interferon related developmental regulator 1 L homeolog antibody, interferon related developmental regulator 1 antibody, ifrd1 antibody, ifrd1.L antibody, IFRD1 antibody, Ifrd1 antibody
- Background
- IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.
- Molecular Weight
- 50 kDa (MW of target protein)
-