PRKY antibody (N-Term)

Catalog No. ABIN632264

Product Details anti-PRKY Antibody

Target: PRKY (Serine/threonine-Protein Kinase PRKY (PRKY))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKY antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRKY antibody was raised against the N terminal of PRKY

Purification: Affinity purified

Immunogen: PRKY antibody was raised using the N terminal of PRKY corresponding to a region with amino acids MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKY Blocking Peptide, catalog no. 33R-5895, is also available for use as a blocking control in assays to test for specificity of this PRKY antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKY

Target: PRKY (Serine/threonine-Protein Kinase PRKY (PRKY))

Alternative Name: PRKY (PRKY Products)

Synonyms: PRKXP3 antibody, PRKYP antibody, protein kinase, Y-linked, pseudogene antibody, PRKY antibody

Background: This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromsoome.

Molecular Weight: 32 kDa (MW of target protein)