PRKAB1 antibody (N-Term)
-
- Target See all PRKAB1 Antibodies
- PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRKAB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRKAB1 antibody was raised against the N terminal of PRKAB1
- Purification
- Affinity purified
- Immunogen
- PRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW
- Top Product
- Discover our top product PRKAB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKAB1 Blocking Peptide, catalog no. 33R-4439, is also available for use as a blocking control in assays to test for specificity of this PRKAB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))
- Alternative Name
- PRKAB1 (PRKAB1 Products)
- Synonyms
- AMPK antibody, HAMPKb antibody, 1300015D22Rik antibody, AU021155 antibody, E430008F22 antibody, MGC82489 antibody, prkab1 antibody, wu:fk93d05 antibody, wu:fw87e09 antibody, zgc:56652 antibody, zgc:76975 antibody, zgc:92228 antibody, protein kinase AMP-activated non-catalytic subunit beta 1 antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit S homeolog antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit, b antibody, protein kinase, AMP-activated, beta 1 non-catalytic subunit, a antibody, PRKAB1 antibody, Prkab1 antibody, prkab1.S antibody, prkab1 antibody, prkab1b antibody, prkab1a antibody
- Background
- The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
- Molecular Weight
- 30 kDa (MW of target protein)
- Pathways
- AMPK Signaling, Warburg Effect
-