RGS5 antibody (Middle Region)
-
- Target See all RGS5 Antibodies
- RGS5 (Regulator of G-Protein Signaling 5 (RGS5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RGS5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RGS5 antibody was raised against the middle region of RGS5
- Purification
- Affinity purified
- Immunogen
- RGS5 antibody was raised using the middle region of RGS5 corresponding to a region with amino acids PGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI
- Top Product
- Discover our top product RGS5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RGS5 Blocking Peptide, catalog no. 33R-7114, is also available for use as a blocking control in assays to test for specificity of this RGS5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RGS5 (Regulator of G-Protein Signaling 5 (RGS5))
- Alternative Name
- RGS5 (RGS5 Products)
- Synonyms
- MST092 antibody, MST106 antibody, MST129 antibody, MSTP032 antibody, MSTP092 antibody, MSTP106 antibody, MSTP129 antibody, RGS5 antibody, 1110070A02Rik antibody, fj30h05 antibody, rgs5 antibody, wu:fj30h05 antibody, zgc:64006 antibody, xrgs5 antibody, MGC147439 antibody, zgc:110206 antibody, regulator of G protein signaling 5 antibody, regulator of G-protein signaling 5 antibody, regulator of G protein signaling 5a antibody, regulator of G-protein signaling 5 L homeolog antibody, regulator of G protein signaling 5b antibody, RGS5 antibody, Rgs5 antibody, rgs5a antibody, rgs5 antibody, rgs5.L antibody, rgs5b antibody
- Background
- The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-