PRMT6 antibody (Middle Region)
-
- Target See all PRMT6 Antibodies
- PRMT6 (Protein Arginine Methyltransferase 6 (PRMT6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRMT6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRMT6 antibody was raised against the middle region of PRMT6
- Purification
- Affinity purified
- Immunogen
- PRMT6 antibody was raised using the middle region of PRMT6 corresponding to a region with amino acids FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLY
- Top Product
- Discover our top product PRMT6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRMT6 Blocking Peptide, catalog no. 33R-3040, is also available for use as a blocking control in assays to test for specificity of this PRMT6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRMT6 (Protein Arginine Methyltransferase 6 (PRMT6))
- Alternative Name
- PRMT6 (PRMT6 Products)
- Synonyms
- CG9927 antibody, DART6 antibody, Dmel\\CG9927 antibody, PRMT6 antibody, HRMT1L6 antibody, ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 6 antibody, ATPRMT6 antibody, protein arginine methyltransferase 6 antibody, DKFZp459B1431 antibody, Hrmt1l6 antibody, hrmt1l6 antibody, hrmt6 antibody, im:6908706 antibody, AW124876 antibody, BB233495 antibody, Arginine methyltransferase 6 antibody, protein arginine methyltransferase 6 antibody, protein arginine methyltransferase 6 S homeolog antibody, arginine N-methyltransferase, type I antibody, protein arginine N-methyltransferase 6 antibody, Art6 antibody, PRMT6 antibody, prmt6.S antibody, prmt6 antibody, Prmt6 antibody
- Background
- Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.
- Molecular Weight
- 35 kDa (MW of target protein)
-