C1orf92 antibody (Middle Region)

Catalog No. ABIN632284

Product Details anti-C1orf92 Antibody

Target: C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1orf92 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF92 antibody was raised against the middle region of C1 rf92

Purification: Affinity purified

Immunogen: C1 ORF92 antibody was raised using the middle region of C1 rf92 corresponding to a region with amino acids VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF92 Blocking Peptide, catalog no. 33R-9468, is also available for use as a blocking control in assays to test for specificity of this C1ORF92 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF92 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1orf92

Target: C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))

Alternative Name: C1ORF92 (LRRC71 Products)

Synonyms: C1orf92 antibody, RP11-356J7.1 antibody, 4933430H15Rik antibody, cilia and flagella associated protein 46 antibody, leucine rich repeat containing 71 antibody, cfap46 antibody, LRRC71 antibody, Lrrc71 antibody

Background: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 39 kDa (MW of target protein)