GRIPAP1 antibody (N-Term)

Catalog No. ABIN632287

Product Details anti-GRIPAP1 Antibody

Target: GRIPAP1 (GRIP1 Associated Protein 1 (GRIPAP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRIPAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GRIPAP1 antibody was raised against the N terminal of GRIPAP1

Purification: Affinity purified

Immunogen: GRIPAP1 antibody was raised using the N terminal of GRIPAP1 corresponding to a region with amino acids ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRIPAP1 Blocking Peptide, catalog no. 33R-2618, is also available for use as a blocking control in assays to test for specificity of this GRIPAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIPAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRIPAP1

Target: GRIPAP1 (GRIP1 Associated Protein 1 (GRIPAP1))

Alternative Name: GRIPAP1 (GRIPAP1 Products)

Synonyms: gripap1 antibody, MGC184827 antibody, zgc:158787 antibody, GRASP-1 antibody, AI854681 antibody, DXImx47e antibody, Sfc10 antibody, mKIAA1167 antibody, Grasp1 antibody, GRIP1 associated protein 1 antibody, gripap1 antibody, GRIPAP1 antibody, Gripap1 antibody

Background: This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms, however, the full-length nature and biological validity of all of these variants have not been determined.

Molecular Weight: 96 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome