GREM2 antibody
-
- Target See all GREM2 Antibodies
- GREM2 (Gremlin 2 (GREM2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GREM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GREM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK
- Top Product
- Discover our top product GREM2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GREM2 Blocking Peptide, catalog no. 33R-6009, is also available for use as a blocking control in assays to test for specificity of this GREM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GREM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GREM2 (Gremlin 2 (GREM2))
- Alternative Name
- GREM2 (GREM2 Products)
- Synonyms
- prdc antibody, zgc:112207 antibody, RGD1560008 antibody, Gremlin2 antibody, Prdc antibody, CKTSF1B2 antibody, DAND3 antibody, PRDC antibody, gremlin 2, DAN family BMP antagonist antibody, gremlin 2, DAN family BMP antagonist b antibody, gremlin 2, cysteine knot superfamily antibody, GREM2 antibody, grem2b antibody, grem2 antibody, Grem2 antibody
- Background
- This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation.
- Molecular Weight
- 17 kDa (MW of target protein)
-