Plastin 3 antibody

Catalog No. ABIN632329

Product Details anti-Plastin 3 Antibody

Target: Plastin 3 (PLS3)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Plastin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Plastin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Plastin 3 Blocking Peptide, catalog no. 33R-8170, is also available for use as a blocking control in assays to test for specificity of this Plastin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Plastin 3

Target: Plastin 3 (PLS3)

Alternative Name: Plastin 3 (PLS3 Products)

Synonyms: T-plastin antibody, AI115446 antibody, AL024105 antibody, T-fimbrin antibody, MGC68681 antibody, t-plastin antibody, MGC106020 antibody, DKFZp459D0939 antibody, PLS3 antibody, Plastin-3 antibody, wu:fc04g03 antibody, zgc:91903 antibody, plastin 3 antibody, plastin 3 (T-isoform) antibody, plastin 3 L homeolog antibody, plastin 3 (T isoform) antibody, PLS3 antibody, Pls3 antibody, pls3.L antibody, pls3 antibody

Background: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.

Molecular Weight: 71 kDa (MW of target protein)