C1ORF74 antibody (N-Term)

Catalog No. ABIN632333

Product Details anti-C1ORF74 Antibody

Target: C1ORF74 (Chromosome 1 Open Reading Frame 74 (C1ORF74))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1ORF74 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF74 antibody was raised against the N terminal Of C1 rf74

Purification: Affinity purified

Immunogen: C1 ORF74 antibody was raised using the N terminal Of C1 rf74 corresponding to a region with amino acids ICLHLAGEVLAVARGLKPAVLYDCNCAGASELQSYLEELKGLGFLTFGLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF74 Blocking Peptide, catalog no. 33R-3903, is also available for use as a blocking control in assays to test for specificity of this C1ORF74 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF74 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1ORF74

Target: C1ORF74 (Chromosome 1 Open Reading Frame 74 (C1ORF74))

Alternative Name: C1ORF74 (C1ORF74 Products)

Synonyms: C1orf74 antibody, DKFZp469F2128 antibody, chromosome 1 open reading frame 74 antibody, chromosome 1 open reading frame 74 L homeolog antibody, chromosome 26 C1orf74 homolog antibody, hypothetical protein LOC100125367 antibody, chromosome 1 open reading frame, human C1orf74 antibody, RIKEN cDNA A130010J15 gene antibody, chromosome ssa22 open reading frame, human C1orf74 antibody, chromosome 16 open reading frame, human C1orf74 antibody, zgc:112163 antibody, C1orf74 antibody, c1orf74.L antibody, c1orf74 antibody, C26H1orf74 antibody, LOC100125367 antibody, C1H1orf74 antibody, A130010J15Rik antibody, cssa22h1orf74 antibody, C16H1orf74 antibody, zgc:112163 antibody

Background: The specific function of C1orf74 is not yet known.

Molecular Weight: 29 kDa (MW of target protein)