RIMKLA antibody (Middle Region)
-
- Target See all RIMKLA Antibodies
- RIMKLA (Ribosomal Modification Protein RimK-Like Family Member A (RIMKLA))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RIMKLA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM80 A antibody was raised against the middle region of FAM80
- Purification
- Affinity purified
- Immunogen
- FAM80 A antibody was raised using the middle region of FAM80 corresponding to a region with amino acids EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV
- Top Product
- Discover our top product RIMKLA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM80A Blocking Peptide, catalog no. 33R-2255, is also available for use as a blocking control in assays to test for specificity of this FAM80A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RIMKLA (Ribosomal Modification Protein RimK-Like Family Member A (RIMKLA))
- Alternative Name
- FAM80A (RIMKLA Products)
- Synonyms
- FAM80A antibody, NAAGS antibody, NAAGS-II antibody, B930030J24 antibody, Rimk antibody, RGD1306880 antibody, ribosomal modification protein rimK like family member A antibody, ribosomal modification protein rimK-like family member A antibody, RIMKLA antibody, Rimkla antibody
- Background
- The specific function of FAM80A is not yet known.
- Molecular Weight
- 38 kDa (MW of target protein)
-