USP12 antibody (Middle Region)

Catalog No. ABIN632371

Product Details anti-USP12 Antibody

Target: USP12 (Ubiquitin Specific Peptidase 12 (USP12))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This USP12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: USP12 antibody was raised against the middle region of USP12

Purification: Affinity purified

Immunogen: USP12 antibody was raised using the middle region of USP12 corresponding to a region with amino acids ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

USP12 Blocking Peptide, catalog no. 33R-4187, is also available for use as a blocking control in assays to test for specificity of this USP12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for USP12

Target: USP12 (Ubiquitin Specific Peptidase 12 (USP12))

Alternative Name: USP12 (USP12 Products)

Synonyms: UBH1 antibody, USP12L1 antibody, usp12 antibody, USP12P1 antibody, sb:eu882 antibody, wu:fi09d12 antibody, Ubh1 antibody, ubh1 antibody, usp12l1 antibody, ubiquitin specific peptidase 12 antibody, ubiquitin specific peptidase 12a antibody, ubiquitin specific peptidase 12 L homeolog antibody, ubiquitin specific peptidase 12 S homeolog antibody, USP12 antibody, usp12 antibody, Usp12 antibody, usp12a antibody, usp12.L antibody, usp12.S antibody

Background: USP12 is a deubiquitinating enzyme. USP12 has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. USP12 is not involved in deubiquitination of monoubiquitinated FANCD2.

Molecular Weight: 43 kDa (MW of target protein)