PITPNB antibody (Middle Region)
-
- Target See all PITPNB Antibodies
- PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PITPNB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PITPNB antibody was raised against the middle region of PITPNB
- Purification
- Affinity purified
- Immunogen
- PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKA
- Top Product
- Discover our top product PITPNB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PITPNB Blocking Peptide, catalog no. 33R-2890, is also available for use as a blocking control in assays to test for specificity of this PITPNB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PITPNB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))
- Alternative Name
- PITPNB (PITPNB Products)
- Synonyms
- VIB1B antibody, MGC75853 antibody, PtdInsTP antibody, PI-TP-beta antibody, pitpn antibody, AI256223 antibody, AU040890 antibody, zgc:56092 antibody, phosphatidylinositol transfer protein, beta antibody, phosphatidylinositol transfer protein, beta L homeolog antibody, phosphatidylinositol transfer protein beta antibody, pitpnb antibody, pitpnb.L antibody, PITPNB antibody, Pitpnb antibody
- Background
- PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.
- Molecular Weight
- 31 kDa (MW of target protein)
-