FAM124A antibody (Middle Region)
-
- Target See all FAM124A products
- FAM124A (Family with Sequence Similarity 124A (FAM124A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM124A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM124 A antibody was raised against the middle region of FAM124
- Purification
- Affinity purified
- Immunogen
- FAM124 A antibody was raised using the middle region of FAM124 corresponding to a region with amino acids VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM124A Blocking Peptide, catalog no. 33R-9824, is also available for use as a blocking control in assays to test for specificity of this FAM124A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM124A (Family with Sequence Similarity 124A (FAM124A))
- Alternative Name
- FAM124A (FAM124A Products)
- Synonyms
- family with sequence similarity 124 member A antibody, FAM124A antibody
- Background
- The function of FAM124A protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 64 kDa (MW of target protein)
-