FAM124A antibody (Middle Region)

Catalog No. ABIN632463

Product Details anti-FAM124A Antibody

Target: FAM124A (Family with Sequence Similarity 124A (FAM124A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM124A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM124 A antibody was raised against the middle region of FAM124

Purification: Affinity purified

Immunogen: FAM124 A antibody was raised using the middle region of FAM124 corresponding to a region with amino acids VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM124A Blocking Peptide, catalog no. 33R-9824, is also available for use as a blocking control in assays to test for specificity of this FAM124A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM124A

Target: FAM124A (Family with Sequence Similarity 124A (FAM124A))

Alternative Name: FAM124A (FAM124A Products)

Synonyms: family with sequence similarity 124 member A antibody, FAM124A antibody

Background: The function of FAM124A protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 64 kDa (MW of target protein)