ACP5 antibody (N-Term)

Catalog No. ABIN632484

Product Details anti-ACP5 Antibody

Target: ACP5 (Acid Phosphatase 5, Tartrate Resistant (ACP5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACP5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACP5 antibody was raised against the N terminal of ACP5

Purification: Affinity purified

Immunogen: ACP5 antibody was raised using the N terminal of ACP5 corresponding to a region with amino acids DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACP5 Blocking Peptide, catalog no. 33R-2079, is also available for use as a blocking control in assays to test for specificity of this ACP5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACP5

Target: ACP5 (Acid Phosphatase 5, Tartrate Resistant (ACP5))

Alternative Name: ACP5 (ACP5 Products)

Synonyms: SPENCDI antibody, TRAP antibody, acp5 antibody, sb:cb576 antibody, zgc:63825 antibody, wu:fb19f01 antibody, wu:fb30b03 antibody, wu:fi14e01 antibody, wu:fj66f03 antibody, MGC78938 antibody, MGC89674 antibody, TR-AP antibody, zgc:92339 antibody, TRACP antibody, TTRRAP antibody, Trap antibody, UF antibody, acid phosphatase 5, tartrate resistant antibody, acid phosphatase 5a, tartrate resistant antibody, acid phosphatase 5, tartrate resistant S homeolog antibody, tartrate resistant acid phosphatase antibody, Tartrate-resistant acid phosphatase type 5 antibody, tartrate-resistant acid phosphatase type 5 antibody, acid phosphatase 5b, tartrate resistant antibody, ACP5 antibody, acp5a antibody, acp5.S antibody, acp5 antibody, NAEGRDRAFT_81291 antibody, ppa5 antibody, LOC100282899 antibody, acp5b antibody, Acp5 antibody

Background: This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis