TGM3 antibody
-
- Target See all TGM3 Antibodies
- TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TGM3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Transglutaminase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS
- Top Product
- Discover our top product TGM3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Transglutaminase 3 Blocking Peptide, catalog no. 33R-5600, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TGM3 (Transglutaminase 3 (E Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM3))
- Alternative Name
- Transglutaminase 3 (TGM3 Products)
- Synonyms
- TGE antibody, TG(E) antibody, AI893889 antibody, RGD1561831 antibody, transglutaminase 3 antibody, transglutaminase 3, E polypeptide antibody, TGM3 antibody, Tgm3 antibody
- Background
- Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds.
- Molecular Weight
- 25 kDa (MW of target protein)
-