ZC2HC1C antibody (N-Term)

Catalog No. ABIN632527

Product Details anti-ZC2HC1C Antibody

Target: ZC2HC1C (Zinc Finger, C2HC-Type Containing 1C (ZC2HC1C))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZC2HC1C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C14 ORF140 antibody was raised against the N terminal Of C14 rf140

Purification: Affinity purified

Immunogen: C14 ORF140 antibody was raised using the N terminal Of C14 rf140 corresponding to a region with amino acids QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF140 Blocking Peptide, catalog no. 33R-7690, is also available for use as a blocking control in assays to test for specificity of this C14ORF140 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF140 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZC2HC1C

Target: ZC2HC1C (Zinc Finger, C2HC-Type Containing 1C (ZC2HC1C))

Alternative Name: C14ORF140 (ZC2HC1C Products)

Synonyms: C14orf140 antibody, FAM164C antibody, 2810002I04Rik antibody, AV046379 antibody, Fam164c antibody, RGD1307122 antibody, zinc finger C2HC-type containing 1C antibody, zinc finger, C2HC-type containing 1C antibody, ZC2HC1C antibody, Zc2hc1c antibody

Background: C14orf140 belongs to the UPF0418 family. The exact function of C14orf140 remains unknown.

Molecular Weight: 31 kDa (MW of target protein)