LDHAL6B antibody (Middle Region)
-
- Target See all LDHAL6B Antibodies
- LDHAL6B (Lactate Dehydrogenase A-Like 6B (LDHAL6B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LDHAL6B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LDHAL6 B antibody was raised against the middle region of LDHAL6
- Purification
- Affinity purified
- Immunogen
- LDHAL6 B antibody was raised using the middle region of LDHAL6 corresponding to a region with amino acids SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA
- Top Product
- Discover our top product LDHAL6B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LDHAL6B Blocking Peptide, catalog no. 33R-8500, is also available for use as a blocking control in assays to test for specificity of this LDHAL6B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHAL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LDHAL6B (Lactate Dehydrogenase A-Like 6B (LDHAL6B))
- Alternative Name
- LDHAL6B (LDHAL6B Products)
- Synonyms
- Ldhl antibody, LDHL antibody, Ldhal antibody, AI326310 antibody, 4933402O15Rik antibody, LDHAL6B antibody, LDH6B antibody, LDHAL6 antibody, lactate dehydrogenase A-like 6B antibody, lactate dehydrogenase A like 6B antibody, Ldhal6b antibody, LDHAL6B antibody
- Background
- The function of LDH protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 42 kDa (MW of target protein)
-