CCSAP antibody (Middle Region)
-
- Target See all CCSAP products
- CCSAP (Centriole, Cilia and Spindle Associated Protein (CCSAP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CCSAP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C1 orf96 antibody was raised against the middle region of C1 rf96
- Purification
- Affinity purified
- Immunogen
- C1 orf96 antibody was raised using the middle region of C1 rf96 corresponding to a region with amino acids ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1orf96 Blocking Peptide, catalog no. 33R-2609, is also available for use as a blocking control in assays to test for specificity of this C1orf96 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf96 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CCSAP (Centriole, Cilia and Spindle Associated Protein (CCSAP))
- Alternative Name
- C1orf96 (CCSAP Products)
- Synonyms
- C1orf96 antibody, CSAP antibody, 1700054N08Rik antibody, AI853424 antibody, centriole, cilia and spindle associated protein antibody, CCSAP antibody, Ccsap antibody
- Background
- The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 30 kDa (MW of target protein)
-