TGDS antibody (Middle Region)
-
- Target See all TGDS products
- TGDS (TDP-Glucose 4,6-Dehydratase (TGDS))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TGDS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TGDS antibody was raised against the middle region of TGDS
- Purification
- Affinity purified
- Immunogen
- TGDS antibody was raised using the middle region of TGDS corresponding to a region with amino acids DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TGDS Blocking Peptide, catalog no. 33R-1924, is also available for use as a blocking control in assays to test for specificity of this TGDS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGDS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TGDS (TDP-Glucose 4,6-Dehydratase (TGDS))
- Alternative Name
- TGDS (TGDS Products)
- Synonyms
- SDR2E1 antibody, TDPGD antibody, 2610017J16Rik antibody, 2610025M23Rik antibody, AI648925 antibody, TDP-glucose 4,6-dehydratase antibody, TGDS antibody, Tgds antibody
- Background
- The function of TGDS protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 40 kDa (MW of target protein)
-