TGDS antibody (Middle Region)

Catalog No. ABIN632577

Product Details anti-TGDS Antibody

Target: TGDS (TDP-Glucose 4,6-Dehydratase (TGDS))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TGDS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TGDS antibody was raised against the middle region of TGDS

Purification: Affinity purified

Immunogen: TGDS antibody was raised using the middle region of TGDS corresponding to a region with amino acids DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TGDS Blocking Peptide, catalog no. 33R-1924, is also available for use as a blocking control in assays to test for specificity of this TGDS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TGDS

Target: TGDS (TDP-Glucose 4,6-Dehydratase (TGDS))

Alternative Name: TGDS (TGDS Products)

Synonyms: SDR2E1 antibody, TDPGD antibody, 2610017J16Rik antibody, 2610025M23Rik antibody, AI648925 antibody, TDP-glucose 4,6-dehydratase antibody, TGDS antibody, Tgds antibody

Background: The function of TGDS protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 40 kDa (MW of target protein)