C3orf33 antibody (Middle Region)

Catalog No. ABIN632605

Product Details anti-C3orf33 Antibody

Target: C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C3orf33 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C3 orf33 antibody was raised against the middle region of C3 rf33

Purification: Affinity purified

Immunogen: C3 orf33 antibody was raised using the middle region of C3 rf33 corresponding to a region with amino acids NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C3orf33 Blocking Peptide, catalog no. 33R-6869, is also available for use as a blocking control in assays to test for specificity of this C3orf33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C3orf33

Target: C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))

Alternative Name: C3orf33 (C3orf33 Products)

Synonyms: AC3-33 antibody, MGC99235 antibody, chromosome 3 open reading frame 33 antibody, chromosome 3 open reading frame 33 L homeolog antibody, RIKEN cDNA E130311K13 gene antibody, C3orf33 antibody, c3orf33.L antibody, E130311K13Rik antibody

Background: The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 29 kDa (MW of target protein)