CRY2 antibody

Catalog No. ABIN632607

Product Details anti-CRY2 Antibody

Target: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRY2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Cryptochrome 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cryptochrome 2 Blocking Peptide, catalog no. 33R-3945, is also available for use as a blocking control in assays to test for specificity of this Cryptochrome 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRY2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRY2

Target: CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))

Alternative Name: Cryptochrome 2 (CRY2 Products)

Synonyms: Cry2 antibody, Cry antibody, GB10211 antibody, CRY2 antibody, AT-PHH1 antibody, ATCRY2 antibody, CRYPTOCHROME 2 APOPROTEIN antibody, F19P19.14 antibody, F19P19_14 antibody, FHA antibody, PHH1 antibody, cryptochrome 2 antibody, HCRY2 antibody, PHLL2 antibody, AV006279 antibody, D130054K12Rik antibody, gCry2 antibody, cryptochrome circadian regulator 2 antibody, cryptochrome 2 antibody, cryptochrome Cry2 antibody, cryptochrome circadian clock 2 antibody, cryptochrome 2 (photolyase-like) antibody, CRY2 antibody, Cry2 antibody, cry2 antibody, LOC100502533 antibody

Background: CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Protein targeting to Nucleus