CRY2 antibody
-
- Target See all CRY2 Antibodies
- CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRY2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Cryptochrome 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE
- Top Product
- Discover our top product CRY2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cryptochrome 2 Blocking Peptide, catalog no. 33R-3945, is also available for use as a blocking control in assays to test for specificity of this Cryptochrome 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRY2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))
- Alternative Name
- Cryptochrome 2 (CRY2 Products)
- Synonyms
- Cry2 antibody, Cry antibody, GB10211 antibody, CRY2 antibody, AT-PHH1 antibody, ATCRY2 antibody, CRYPTOCHROME 2 APOPROTEIN antibody, F19P19.14 antibody, F19P19_14 antibody, FHA antibody, PHH1 antibody, cryptochrome 2 antibody, HCRY2 antibody, PHLL2 antibody, AV006279 antibody, D130054K12Rik antibody, gCry2 antibody, cryptochrome circadian regulator 2 antibody, cryptochrome 2 antibody, cryptochrome Cry2 antibody, cryptochrome circadian clock 2 antibody, cryptochrome 2 (photolyase-like) antibody, CRY2 antibody, Cry2 antibody, cry2 antibody, LOC100502533 antibody
- Background
- CRY2 is a blue light-dependent regulator of the circadian feedback loop.CRY2 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. CRY2 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity.
- Molecular Weight
- 67 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation, Protein targeting to Nucleus
-