RP11-298P3.3 (N-Term) antibody
-
- Target
- RP11-298P3.3
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- RP11-298 P3.3 antibody was raised against the N terminal of RP11-298 3.3
- Purification
- Affinity purified
- Immunogen
- RP11-298 P3.3 antibody was raised using the N terminal of RP11-298 3.3 corresponding to a region with amino acids EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RP11-298P3.3 Blocking Peptide, catalog no. 33R-2828, is also available for use as a blocking control in assays to test for specificity of this RP11-298P3.3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-290 3.3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RP11-298P3.3
- Background
- The function of RP11-298P3.3 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 87 kDa (MW of target protein)
-