TMC8 antibody (N-Term)

Catalog No. ABIN632629

Product Details anti-TMC8 Antibody

Target: TMC8 (Transmembrane Channel-Like 8 (TMC8))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMC8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMC8 antibody was raised against the N terminal of TMC8

Purification: Affinity purified

Immunogen: TMC8 antibody was raised using the N terminal of TMC8 corresponding to a region with amino acids PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMC8 Blocking Peptide, catalog no. 33R-7123, is also available for use as a blocking control in assays to test for specificity of this TMC8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMC8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMC8

Target: TMC8 (Transmembrane Channel-Like 8 (TMC8))

Alternative Name: TMC8 (TMC8 Products)

Synonyms: EV2 antibody, EVER2 antibody, EVIN2 antibody, Ever2 antibody, mFLJ00400 antibody, transmembrane channel like 8 antibody, transmembrane channel-like 8 antibody, transmembrane channel-like gene family 8 antibody, TMC8 antibody, Tmc8 antibody

Background: Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels.

Molecular Weight: 82 kDa (MW of target protein)