CHMP1B antibody (N-Term)

Catalog No. ABIN632659

Product Details anti-CHMP1B Antibody

Target: CHMP1B (Charged Multivesicular Body Protein 1B (CHMP1B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHMP1B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CHMP1 B antibody was raised against the N terminal of CHMP1

Purification: Affinity purified

Immunogen: CHMP1 B antibody was raised using the N terminal of CHMP1 corresponding to a region with amino acids KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHMP1B Blocking Peptide, catalog no. 33R-4435, is also available for use as a blocking control in assays to test for specificity of this CHMP1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHMP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHMP1B

Target: CHMP1B (Charged Multivesicular Body Protein 1B (CHMP1B))

Alternative Name: CHMP1B (CHMP1B Products)

Synonyms: C10orf2 antibody, C18-ORF2 antibody, C18orf2 antibody, CHMP1.5 antibody, Vps46-2 antibody, Vps46B antibody, hVps46-2 antibody, 2810405I11Rik antibody, Chmp1b1 antibody, Chmp1.5 antibody, fb10c03 antibody, wu:fb10c03 antibody, zgc:56134 antibody, chromatin modifying protein 1b antibody, hypothetical protein antibody, charged multivesicular body protein 1B antibody, chromatin modifying protein 1B antibody, LOC692931 antibody, PGTG_18215 antibody, CHMP1B antibody, Chmp1b antibody, chmp1b antibody

Background: CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression.

Molecular Weight: 22 kDa (MW of target protein)