C1orf131 antibody (Middle Region)

Catalog No. ABIN632663

Product Details anti-C1orf131 Antibody

Target: C1orf131 (Chromosome 1 Open Reading Frame 131 (C1orf131))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1orf131 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF131 antibody was raised against the middle region of C1 rf131

Purification: Affinity purified

Immunogen: C1 ORF131 antibody was raised using the middle region of C1 rf131 corresponding to a region with amino acids TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF131 Blocking Peptide, catalog no. 33R-9091, is also available for use as a blocking control in assays to test for specificity of this C1ORF131 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF131 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1orf131

Target: C1orf131 (Chromosome 1 Open Reading Frame 131 (C1orf131))

Alternative Name: C1ORF131 (C1orf131 Products)

Synonyms: C3H1orf131 antibody, 3110004G14Rik antibody, Ayu21-55 antibody, Gt(pU21)55Imeg antibody, GtAyu21-55 antibody, chromosome 1 open reading frame 131 antibody, chromosome 3 open reading frame, human C1orf131 antibody, RIKEN cDNA 2810004N23 gene antibody, similar to RIKEN cDNA 0610039J04 antibody, C1orf131 antibody, C3H1ORF131 antibody, c1orf131 antibody, 2810004N23Rik antibody, RGD1562218 antibody

Background: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 32 kDa (MW of target protein)