BDH2 antibody (Middle Region)
-
- Target See all BDH2 Antibodies
- BDH2 (3-hydroxybutyrate Dehydrogenase, Type 2 (BDH2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BDH2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BDH2 antibody was raised against the middle region of BDH2
- Purification
- Affinity purified
- Immunogen
- BDH2 antibody was raised using the middle region of BDH2 corresponding to a region with amino acids NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR
- Top Product
- Discover our top product BDH2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BDH2 Blocking Peptide, catalog no. 33R-6852, is also available for use as a blocking control in assays to test for specificity of this BDH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BDH2 (3-hydroxybutyrate Dehydrogenase, Type 2 (BDH2))
- Alternative Name
- BDH2 (BDH2 Products)
- Synonyms
- DHRS6 antibody, BDH2 antibody, bdh2 antibody, EFA6R antibody, PRO20933 antibody, SDR15C1 antibody, UCPA-OR antibody, UNQ6308 antibody, 1810026B04Rik antibody, Dhrs6 antibody, zgc:110323 antibody, 3-hydroxybutyrate dehydrogenase, type 2 antibody, 3-hydroxybutyrate dehydrogenase 2 antibody, 3-hydroxybutyrate dehydrogenase 2 L homeolog antibody, BDH2 antibody, bdh2 antibody, Bdh2 antibody, bdh2.L antibody
- Background
- BDH2 is a dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron homeostasis and transport. It also acts as a 3-hydroxybutyrate dehydrogenase.
- Molecular Weight
- 27 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Monocarboxylic Acid Catabolic Process
-