TNNI3K antibody (Middle Region)
-
- Target See all TNNI3K Antibodies
- TNNI3K (TNNI3 Interacting Kinase (TNNI3K))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TNNI3K antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TNNI3 K antibody was raised against the middle region of TNNI3
- Purification
- Affinity purified
- Immunogen
- TNNI3 K antibody was raised using the middle region of TNNI3 corresponding to a region with amino acids PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY
- Top Product
- Discover our top product TNNI3K Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TNNI3K Blocking Peptide, catalog no. 33R-7128, is also available for use as a blocking control in assays to test for specificity of this TNNI3K antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNNI3K (TNNI3 Interacting Kinase (TNNI3K))
- Alternative Name
- TNNI3K (TNNI3K Products)
- Synonyms
- CARK antibody, Cark antibody, D830019J24Rik antibody, TNNI3 interacting kinase antibody, serine/threonine-protein kinase TNNI3K antibody, TNNI3K antibody, LOC100592286 antibody, Tnni3k antibody
- Background
- TNNI3K may play a role in cardiac physiology.
- Molecular Weight
- 93 kDa (MW of target protein)
-