PM20D2 antibody (Middle Region)
-
- Target See all PM20D2 products
- PM20D2 (Peptidase M20 Domain Containing 2 (PM20D2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PM20D2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PM20 D2 antibody was raised against the middle region of PM20 2
- Purification
- Affinity purified
- Immunogen
- PM20 D2 antibody was raised using the middle region of PM20 2 corresponding to a region with amino acids HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PM20D2 Blocking Peptide, catalog no. 33R-3738, is also available for use as a blocking control in assays to test for specificity of this PM20D2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PM20 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PM20D2 (Peptidase M20 Domain Containing 2 (PM20D2))
- Alternative Name
- PM20D2 (PM20D2 Products)
- Synonyms
- ACY1L2 antibody, bA63L7.3 antibody, Acy1l2 antibody, Gm424 antibody, peptidase M20 domain containing 2 antibody, PM20D2 antibody, Pm20d2 antibody
- Background
- PM20D2 belongs to the peptidase M20A family. The function of PM20D2 remains unknown.
- Molecular Weight
- 48 kDa (MW of target protein)
-