CELA1 antibody (N-Term)

Catalog No. ABIN632696

Product Details anti-CELA1 Antibody

Target: CELA1 (Chymotrypsin-Like Elastase Family, Member 1 (CELA1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CELA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Elastase 1 antibody (Pancreatic) was raised against the N terminal of ELA1

Purification: Affinity purified

Immunogen: Elastase 1 antibody (Pancreatic) was raised using the N terminal of ELA1 corresponding to a region with amino acids LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Elastase 1 Blocking Peptide (Pancreatic), catalog no. 33R-5528, is also available for use as a blocking control in assays to test for specificity of this Elastase 1 antibody (Pancreatic)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CELA1

Target: CELA1 (Chymotrypsin-Like Elastase Family, Member 1 (CELA1))

Alternative Name: Elastase 1 (CELA1 Products)

Synonyms: ELA1 antibody, 1810009A17Rik antibody, 1810062B19Rik antibody, Ela-1 antibody, Ela1 antibody, PC-TsF antibody, ela1 antibody, ELS1 antibody, Elastase-1 antibody, ELAI1 antibody, RATELAI1 antibody, chymotrypsin like elastase family member 1 antibody, chymotrypsin-like elastase family, member 1 antibody, CELA1 antibody, Cela1 antibody, cela1 antibody

Background: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 (ELA1) expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas is actually referring to elastase 2A.

Molecular Weight: 28 kDa (MW of target protein)