DYNC1I1 antibody (N-Term)

Catalog No. ABIN632697

Product Details anti-DYNC1I1 Antibody

Target: DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DYNC1I1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DYNC1 I1 antibody was raised against the N terminal of DYNC1 1

Purification: Affinity purified

Immunogen: DYNC1 I1 antibody was raised using the N terminal of DYNC1 1 corresponding to a region with amino acids IREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DYNC1I1 Blocking Peptide, catalog no. 33R-4130, is also available for use as a blocking control in assays to test for specificity of this DYNC1I1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNC0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DYNC1I1

Target: DYNC1I1 (Dynein, Cytoplasmic 1, Intermediate Chain 1 (DYNC1I1))

Alternative Name: DYNC1I1 (DYNC1I1 Products)

Synonyms: Dnci1 antibody, Dncic1 antibody, DH IC-1 antibody, DHIC-1 antibody, DIC antibody, IC74 antibody, DNCI1 antibody, DNCIC1 antibody, dynein cytoplasmic 1 intermediate chain 1 antibody, Dync1i1 antibody, DYNC1I1 antibody

Background: DYNC1I1 belongs to the dynein intermediate chain family. It contains 7 WD repeats. The intermediate chains seem to help dynein bind to dynactin 150 kDa component. DYNC1I1 may play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.

Molecular Weight: 73 kDa (MW of target protein)