C11ORF74 antibody (Middle Region)
-
- Target See all C11ORF74 Antibodies
- C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C11ORF74 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C11 ORF74 antibody was raised against the middle region of C11 rf74
- Purification
- Affinity purified
- Immunogen
- C11 ORF74 antibody was raised using the middle region of C11 rf74 corresponding to a region with amino acids VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD
- Top Product
- Discover our top product C11ORF74 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C11ORF74 Blocking Peptide, catalog no. 33R-9749, is also available for use as a blocking control in assays to test for specificity of this C11ORF74 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF74 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))
- Alternative Name
- C11ORF74 (C11ORF74 Products)
- Synonyms
- HEPIS antibody, chromosome 11 open reading frame 74 antibody, chromosome 5 C11orf74 homolog antibody, C11orf74 antibody, C5H11orf74 antibody, c11orf74 antibody
- Background
- The function of C11orf74 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 25 kDa (MW of target protein)
-