FAM161B antibody (Middle Region)
-
- Target See all FAM161B products
- FAM161B (Family with Sequence Similarity 161, Member B (FAM161B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM161B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C14 ORF44 antibody was raised against the middle region of C14 rf44
- Purification
- Affinity purified
- Immunogen
- C14 ORF44 antibody was raised using the middle region of C14 rf44 corresponding to a region with amino acids AMDPHKSLEEVFKAKLKENRNNDRKRAKEYKKELEEMKQRIQTRPYLFEQ
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C14ORF44 Blocking Peptide, catalog no. 33R-1385, is also available for use as a blocking control in assays to test for specificity of this C14ORF44 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF44 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM161B (Family with Sequence Similarity 161, Member B (FAM161B))
- Alternative Name
- C14ORF44 (FAM161B Products)
- Synonyms
- C14orf44 antibody, c14_5547 antibody, 9330169D17 antibody, 9830169C18Rik antibody, RGD1309058 antibody, family with sequence similarity 161 member B antibody, family with sequence similarity 161, member B antibody, FAM161B antibody, Fam161b antibody
- Background
- The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 74 kDa (MW of target protein)
-