FAM76A antibody (N-Term)

Catalog No. ABIN632747

Product Details anti-FAM76A Antibody

Target: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM76A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM76 A antibody was raised against the N terminal of FAM76

Purification: Affinity purified

Immunogen: FAM76 A antibody was raised using the N terminal of FAM76 corresponding to a region with amino acids MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM76A Blocking Peptide, catalog no. 33R-5601, is also available for use as a blocking control in assays to test for specificity of this FAM76A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM76A

Target: FAM76A (Family with Sequence Similarity 76, Member A (FAM76A))

Alternative Name: FAM76A (FAM76A Products)

Synonyms: RGD1305162 antibody, family with sequence similarity 76 member A antibody, family with sequence similarity 76, member A antibody, FAM76A antibody, Fam76a antibody

Background: The specific function of FAM76A is not yet known.

Molecular Weight: 35 kDa (MW of target protein)