C19orf21 antibody (C-Term)

Catalog No. ABIN632766

Product Details anti-C19orf21 Antibody

Target: C19orf21 (MISP) (Mitotic Spindle Positioning (MISP))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C19orf21 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C19 ORF21 antibody was raised against the C terminal Of C19 rf21

Purification: Affinity purified

Immunogen: C19 ORF21 antibody was raised using the C terminal Of C19 rf21 corresponding to a region with amino acids RRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C19ORF21 Blocking Peptide, catalog no. 33R-8150, is also available for use as a blocking control in assays to test for specificity of this C19ORF21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C19orf21

Target: C19orf21 (MISP) (Mitotic Spindle Positioning (MISP))

Alternative Name: C19ORF21 (MISP Products)

Synonyms: C19orf21 antibody, 9130017N09Rik antibody, mitotic spindle positioning antibody, MISP antibody, Misp antibody

Background: The function of C19orf21 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 75 kDa (MW of target protein)