DCUN1D4 antibody
-
- Target See all DCUN1D4 Antibodies
- DCUN1D4 (DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (DCUN1D4))
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DCUN1D4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DCUN1 D4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL
- Top Product
- Discover our top product DCUN1D4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DCUN1D4 Blocking Peptide, catalog no. 33R-10181, is also available for use as a blocking control in assays to test for specificity of this DCUN1D4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCUN0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DCUN1D4 (DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (DCUN1D4))
- Alternative Name
- DCUN1D4 (DCUN1D4 Products)
- Synonyms
- RGD1310422 antibody, si:ch211-14g4.1 antibody, AI836376 antibody, DCN1-like protein 4 antibody, defective in cullin neddylation 1 domain containing 4 antibody, DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) antibody, LOC100282616 antibody, LOC100283419 antibody, dcnl4 antibody, DCUN1D4 antibody, Dcun1d4 antibody, dcun1d4 antibody
- Background
- DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.
- Molecular Weight
- 34 kDa (MW of target protein)
-