CHORDC1 antibody
-
- Target See all CHORDC1 Antibodies
- CHORDC1 (Cysteine and Histidine-Rich Domain (CHORD)-Containing 1 (CHORDC1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHORDC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CHORDC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP
- Top Product
- Discover our top product CHORDC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHORDC1 Blocking Peptide, catalog no. 33R-8501, is also available for use as a blocking control in assays to test for specificity of this CHORDC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHORDC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHORDC1 (Cysteine and Histidine-Rich Domain (CHORD)-Containing 1 (CHORDC1))
- Alternative Name
- CHORDC1 (CHORDC1 Products)
- Synonyms
- CHP1 antibody, CHP-1 antibody, MGC89160 antibody, NV16801 antibody, Chp-1 antibody, Morgana antibody, 1110001O09Rik antibody, AA409036 antibody, morgana antibody, zgc:63894 antibody, cysteine and histidine rich domain containing 1 antibody, cysteine and histidine-rich domain-containing protein antibody, cysteine and histidine rich domain containing 1 S homeolog antibody, cysteine and histidine-rich domain (CHORD)-containing 1 antibody, cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1 antibody, cysteine and histidine-rich domain (CHORD) containing 1b antibody, CHORDC1 antibody, Chordc1 antibody, LOC412067 antibody, chordc1.S antibody, chordc1 antibody, chordc1b antibody
- Background
- CHORDC1 may be play a role in the regulation of NOD1 via its interaction with HSP90AA1.
- Molecular Weight
- 37 kDa (MW of target protein)
-