BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) antibody

Catalog No. ABIN632802

The Rabbit Polyclonal anti-BRISC and BRCA1 A Complex Member 1 antibody (ABIN632802) specifically detects BRISC and BRCA1 A Complex Member 1 in WB. The antibody is reactive with Human samples.

Quick Overview for BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) antibody (ABIN632802)

Target: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: C19 ORF62 antibody was raised against the N terminal Of C19 rf62

Purification: Affinity purified

Immunogen: C19 ORF62 antibody was raised using the N terminal Of C19 rf62 corresponding to a region with amino acids DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C19ORF62 Blocking Peptide, (ABIN937526), is also available for use as a blocking control in assays to test for specificity of this C19ORF62 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF62 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Alternative Name: C19ORF62

Background: C19orf62 is a component of the BRCA1-A complex, a complex that specifically recognises 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs).

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus