BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) antibody
-
- Target See all BRISC and BRCA1 A Complex Member 1 (BABAM1) Antibodies
- BRISC and BRCA1 A Complex Member 1 (BABAM1)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C19 ORF62 antibody was raised against the N terminal Of C19 rf62
- Purification
- Affinity purified
- Immunogen
- C19 ORF62 antibody was raised using the N terminal Of C19 rf62 corresponding to a region with amino acids DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR
- Top Product
- Discover our top product BABAM1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C19ORF62 Blocking Peptide, catalog no. 33R-2140, is also available for use as a blocking control in assays to test for specificity of this C19ORF62 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF62 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BRISC and BRCA1 A Complex Member 1 (BABAM1)
- Alternative Name
- C19ORF62 (BABAM1 Products)
- Synonyms
- merit40 antibody, nba1 antibody, zgc:100909 antibody, c19orf62 antibody, C19orf62 antibody, MERIT40 antibody, NBA1 antibody, C7H19orf62 antibody, 5430437P03Rik antibody, Merit40 antibody, BRISC and BRCA1 A complex member 1 antibody, BRISC and BRCA1 A complex member 1 L homeolog antibody, babam1 antibody, BABAM1 antibody, babam1.L antibody, Babam1 antibody
- Background
- C19orf62 is a component of the BRCA1-A complex, a complex that specifically recognises 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs).
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Positive Regulation of Response to DNA Damage Stimulus
-