PPWD1 antibody (Middle Region)
-
- Target See all PPWD1 Antibodies
- PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPWD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PPWD1 antibody was raised against the middle region of PPWD1
- Purification
- Affinity purified
- Immunogen
- PPWD1 antibody was raised using the middle region of PPWD1 corresponding to a region with amino acids FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG
- Top Product
- Discover our top product PPWD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPWD1 Blocking Peptide, catalog no. 33R-2998, is also available for use as a blocking control in assays to test for specificity of this PPWD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPWD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPWD1 (Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1))
- Alternative Name
- PPWD1 (PPWD1 Products)
- Synonyms
- zgc:165355 antibody, 4632422M10Rik antibody, A330090G21Rik antibody, RGD1310204 antibody, peptidylprolyl isomerase domain and WD repeat containing 1 antibody, peptidylprolyl isomerase domain and WD repeat containing 1 S homeolog antibody, PPWD1 antibody, ppwd1 antibody, ppwd1.S antibody, Ppwd1 antibody
- Background
- PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.
- Molecular Weight
- 73 kDa (MW of target protein)
-