C4orf22 antibody (N-Term)

Catalog No. ABIN632825

Product Details anti-C4orf22 Antibody

Target: C4orf22 (Chromosome 4 Open Reading Frame 22 (C4orf22))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C4orf22 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C4 ORF22 antibody was raised against the N terminal Of C4 rf22

Purification: Affinity purified

Immunogen: C4 ORF22 antibody was raised using the N terminal Of C4 rf22 corresponding to a region with amino acids YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C4ORF22 Blocking Peptide, catalog no. 33R-10163, is also available for use as a blocking control in assays to test for specificity of this C4ORF22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C4orf22

Target: C4orf22 (Chromosome 4 Open Reading Frame 22 (C4orf22))

Alternative Name: C4ORF22 (C4orf22 Products)

Synonyms: chromosome 4 open reading frame 22 antibody, C4orf22 antibody

Background: The specific function of C4orf22 is not yet known.

Molecular Weight: 27 kDa (MW of target protein)