KRT18P55 antibody (N-Term)
KRT18P55
Reactivity: Human
WB
Host: Rabbit
Polyclonal
unconjugated
1 image
-
- Target See all KRT18P55 products
- KRT18P55 (Keratin 18 Pseudogene 55 (KRT18P55))
- Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KRT18P55 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- FLJ40504 antibody was raised against the N terminal of FLJ40504
- Purification
- Affinity purified
- Immunogen
- FLJ40504 antibody was raised using the N terminal of FLJ40504 corresponding to a region with amino acids MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQL
-
anti-Keratin 18 Pseudogene 55 (KRT18P55) (AA 1-259) antibody
KRT18P55 Reactivity: Human WB Host: Mouse Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FLJ40504 Blocking Peptide, catalog no. 33R-5837, is also available for use as a blocking control in assays to test for specificity of this FLJ40504 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ40504 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KRT18P55 (Keratin 18 Pseudogene 55 (KRT18P55))
- Alternative Name
- FLJ40504 (KRT18P55 Products)
- Synonyms
- keratin 18 pseudogene 55 antibody, KRT18P55 antibody
- Background
- The specific function of FFLJ40504 is not yet known.
- Molecular Weight
- 29 kDa (MW of target protein)
-
You are here:
