PEPD antibody (Middle Region)
-
- Target See all PEPD Antibodies
- PEPD (Peptidase D (PEPD))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PEPD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Peptidase D antibody was raised against the middle region of PEPD
- Purification
- Affinity purified
- Immunogen
- Peptidase D antibody was raised using the middle region of PEPD corresponding to a region with amino acids LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV
- Top Product
- Discover our top product PEPD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Peptidase D Blocking Peptide, catalog no. 33R-4964, is also available for use as a blocking control in assays to test for specificity of this Peptidase D antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEPD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEPD (Peptidase D (PEPD))
- Alternative Name
- Peptidase D (PEPD Products)
- Synonyms
- MGC89151 antibody, DDBDRAFT_0190220 antibody, DDBDRAFT_0266378 antibody, DDB_0190220 antibody, DDB_0266378 antibody, PROLIDASE antibody, cb1000 antibody, fj78g11 antibody, wu:fj78g11 antibody, prolidase antibody, Pep-4 antibody, Pep4 antibody, peptidase D antibody, peptidase D L homeolog antibody, pepd antibody, pepD antibody, PEPD antibody, pepd.L antibody, Pepd antibody
- Background
- Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.
- Molecular Weight
- 54 kDa (MW of target protein)
-