ODF2L antibody (N-Term)

Catalog No. ABIN632872

Product Details anti-ODF2L Antibody

Target: ODF2L (Outer Dense Fiber of Sperm Tails 2-Like (ODF2L))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ODF2L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ODF2 L antibody was raised against the N terminal of ODF2

Purification: Affinity purified

Immunogen: ODF2 L antibody was raised using the N terminal of ODF2 corresponding to a region with amino acids KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ODF2L Blocking Peptide, catalog no. 33R-4698, is also available for use as a blocking control in assays to test for specificity of this ODF2L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ODF2L

Target: ODF2L (Outer Dense Fiber of Sperm Tails 2-Like (ODF2L))

Alternative Name: ODF2L (ODF2L Products)

Synonyms: im:7137744 antibody, wu:fc04b05 antibody, RP5-977L11.1 antibody, dJ977L11.1 antibody, 4733401D09Rik antibody, 9630045K08Rik antibody, D3Ertd250e antibody, RGD1308397 antibody, outer dense fiber of sperm tails 2 like antibody, outer dense fiber of sperm tails 2b antibody, outer dense fiber protein 2-like antibody, outer dense fiber of sperm tails 2-like antibody, outer dense fiber of sperm tails 2-like L homeolog antibody, ODF2L antibody, odf2b antibody, LOC100366442 antibody, Odf2l antibody, odf2l.L antibody

Background: The function of ODF2L protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 60 kDa (MW of target protein)